PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G09540.1
Common NameATMYB61, MYB61
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 366aa    MW: 40891.4 Da    PI: 8.0733
Description myb domain protein 61
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G09540.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.79.5e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l+  ++ +G g+W+++++  g+ R++k+c++rw +yl
      AT1G09540.1 14 KGLWSPEEDEKLLTHITNHGHGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

2Myb_DNA-binding48.12.6e-1567109145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      rg++++eE+ l+v++++ lG++ W+ Ia++++ gRt++++k+ w+
      AT1G09540.1  67 RGAFSPEEENLIVELHAVLGNR-WSQIASRLP-GRTDNEIKNLWN 109
                      89********************.*********.*********998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.9E-27664IPR009057Homeodomain-like
PROSITE profilePS5129417.513961IPR017930Myb domain
SuperFamilySSF466897.49E-2912108IPR009057Homeodomain-like
SMARTSM007171.0E-111363IPR001005SANT/Myb domain
PfamPF002491.5E-141461IPR001005SANT/Myb domain
CDDcd001671.02E-101761No hitNo description
PROSITE profilePS5129424.98362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-2565117IPR009057Homeodomain-like
SMARTSM007171.4E-1366114IPR001005SANT/Myb domain
PfamPF002494.6E-1467109IPR001005SANT/Myb domain
CDDcd001672.57E-1069109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001944Biological Processvasculature development
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009733Biological Processresponse to auxin
GO:0010089Biological Processxylem development
GO:0010119Biological Processregulation of stomatal movement
GO:0010214Biological Processseed coat development
GO:0030154Biological Processcell differentiation
GO:0048364Biological Processroot development
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
PO:0005352anatomyxylem
PO:0009005anatomyroot
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLTHIT NHGHGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGAF SPEEENLIVE LHAVLGNRWS QIASRLPGRT DNEIKNLWNS SIKKKLKQRG  120
IDPNTHKPIS EVESFSDKDK PTTSNNKRSG NDHKSPSSSS ATNQDFFLER PSDLSDYFGF  180
QKLNFNSNLG LSVTTDSSLC SMIPPQFSPG NMVGSVLQTP VCVKPSISLP PDNNSSSPIS  240
GGDHVKLAAP NWEFQTNNNN TSNFFDNGGF SWSIPNSSTS SSQVKPNHNF EEIKWSEYLN  300
TPFFIGSTVQ SQTSQPIYIK SETDYLANVS NMTDPWSQNE NLGTTETSDV FSKDLQRMAV  360
SFGQSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-28121165108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.109130.0flower
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible264556_at0.0
Expression AtlasAT1G09540-
AtGenExpressAT1G09540-
Functional Description ? help Back to Top
Source Description
TAIREncodes putative transcription factor. Mutants lack of mucilage extrusion from the seeds during imbibition. Reduced quantities of mucilage are deposited during the development of the seed coat epidermis in myb61 mutants. Expressed in guard cells,loss of function mutations show an increase in stomatal pore opening suggesting a role in ABA independent regulation of stomatal pore size.
Function -- GeneRIF ? help Back to Top
  1. AtMYB61 is an R2R3-MYB transcription factor controlling stomatal aperture in Arabidopsis thaliana.
    [PMID: 16005292]
  2. AtMYB61 links the transcriptional control of multiple aspects of plant resource allocation.
    [PMID: 22708996]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00134DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G09540.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDauxin
Interaction ? help Back to Top
Source Intact With
BioGRIDAT1G14920
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G09540
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0639390.0AY063939.1 Arabidopsis thaliana putative transcription factor (At1g09540) mRNA, complete cds.
GenBankAY0965230.0AY096523.1 Arabidopsis thaliana putative transcription factor protein (At1g09540) mRNA, complete cds.
GenBankAY5195520.0AY519552.1 Arabidopsis thaliana MYB transcription factor (At1g09540) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_172425.20.0myb domain protein 61
TrEMBLQ8VZQ20.0Q8VZQ2_ARATH; MYB transcription factor
STRINGAT1G09540.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Penfield S,Meissner RC,Shoue DA,Carpita NC,Bevan MW
    MYB61 is required for mucilage deposition and extrusion in the Arabidopsis seed coat.
    Plant Cell, 2001. 13(12): p. 2777-91
    [PMID:11752387]
  4. Liang YK, et al.
    AtMYB61, an R2R3-MYB transcription factor controlling stomatal aperture in Arabidopsis thaliana.
    Curr. Biol., 2005. 15(13): p. 1201-6
    [PMID:16005292]
  5. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  6. Arsovski AA,Villota MM,Rowland O,Subramaniam R,Western TL
    MUM ENHANCERS are important for seed coat mucilage production and mucilage secretory cell differentiation in Arabidopsis thaliana.
    J. Exp. Bot., 2009. 60(9): p. 2601-12
    [PMID:19401413]
  7. Romano JM, et al.
    AtMYB61, an R2R3-MYB transcription factor, functions as a pleiotropic regulator via a small gene network.
    New Phytol., 2012. 195(4): p. 774-86
    [PMID:22708996]
  8. Prouse MB,Campbell MM
    Interactions between the R2R3-MYB transcription factor, AtMYB61, and target DNA binding sites.
    PLoS ONE, 2013. 8(5): p. e65132
    [PMID:23741471]
  9. Mar
    Large-scale identification of gibberellin-related transcription factors defines group VII ETHYLENE RESPONSE FACTORS as functional DELLA partners.
    Plant Physiol., 2014. 166(2): p. 1022-32
    [PMID:25118255]